EFTA00269187.pdf

. 10117/22,10:31 AM Gmell - Your info was found on the dark web 1271-ACK PlAWe er 5 °C4 A Z- t- 4613 ( A livOcx4.)ctifle-Aff + znr-efur calc.es M Gmail Jacqueline E*GANSED CRtHE CRot-1(1414/— ME-TWORK -fritcern N)6 or raw . Your info was found on the dark web 'I message CP:Feej > Re -T : To: -LDEMTIT--/ 1-1-1 e Fr - 'SARK WES - _,McAfee logo EV t oci.,;ce, 3LACR MARKET ti3V4Co)er-falr c -Th tober 2022 at 05:12 View in browser Identity Protection Services A Your info was stolen! Your date of birth was found on the dark weli) You asked us to keep a look out for‘tDlen_personap ir c7;;;TiEwlExpand your protection by adding more information for us to monitor. Show me Your personal personal info was stolen in a data breaa, but we're right here with you. We'll guide you through every step of the way to become safer again. if you believe your personal information was added for monitoring by accident or without your approval, you can remove the asset by logging into your account or by contacting McAfee Customer Support for assistance. . in in:I.—I-n.701 • A.••• -- Miteagant=011inlarTtilifirthrilatt.PLIA1746n55364161008493RAMOI=MSCi"3A1746055... 1/3 EFTA00269187 10117722,10:37 AM Grind - Your info was found on the dark web How did hackers get my info? They usually take it by hacking into company databases you might :lave an online account with. Then they share or sell ail of this info to other hackers in remote places in the Internet called the dark web. What do they use it for? Hackers can use this info to try and access your banking. social media, or shopping accounts. Or, they use it to send you phony links to fake websites that try and trick you out of your credit card numbers and other info. How can we help? While no one can get your info back from the dark web, we warn you when we find it there and show you all the ways to take back control from hackers. We're here for you. Stay safe, QL1cAfee Tear) This message is being sent from: McAfee, LLC (United States, Mexico, Central America, South America, the Caribbean, Japan); McAfee Consumer Affairs North, LLC (Canada); McAfee Ireland Limited (Europe, Middle • ...- ahannw-wymnanmvievigetplaseacch=all&pennthid-athreada3A17460553641 6100849 38simpl=msg-f%3 A1746055... 213 EFTA00269188 8/25/22, 2:37 PM Goma - Your enquiry to the eSafety Commissioner: Et4Q-2022-0000919 (SECIs0FFICIAL:Sensitivej CRM:0012589 as Gmail RE-Coe-WISED A5 Jacqueline O R.C,PAWW...mtt cpapie AND cie.tritNtv_ Acrwt -ry 1 message Online To: Jacque C 24 August 202 at 09:11 Dear Jacqueline, Thank you for your information received by the Safety Commis;;er>and taking the time to write to us. (The rep concerns you have raisedareasedo eemkand we recommend that you seek legal advice and contact the police to ort criminal activity or orgem et} If you ever feel that you or your family are in immediate danger, please call Triple Zero - 000. If you wish to discuss this matter with a legal professional, you can contact Legal Services Commission South Australia for free by calling Further information about their services Is available from their website here: https://lsc.sa.gov.au The eSafety Commissioner can only investigate matters that are contained in the Online Safety Act 2021 (Cth). We can take action to remove harmful content from the intemet, but we are unable to investigate people or reports of illegal activity. Further information and resources about the eSafety Commissioner's role is available from our website at: www.esafety.gov.au We hope this information is of assistance. Illegal and Restricted Content Team eSafety Commissioner E W www.esafety.gov.au eSafetyCommissioner 1saialist, loscroaawed NOTICE: This email message is for the sole use of the intended recipient(s) and may contain confidential and privileged information. My unauthorized review, use, disclosure or distribution is prohibited. If you are not the intended recipient, please contact the sender by reply email and destroy all copies of the original message. 41.• d nnw 4 /4 EFTA00269189 N29/2021 Gmail - Report Abuse ,*oc Gmail Report Abuse 1 message Jacqueline Pearce <== - REPiZejci\n-v9"TiVe- c..*o - n . S`Or.LIE`l HI Jacqueline, We heard you. Please report malicious activity to thsi email. Thank You. •1/4_ e-E)AcrtuS 0t.4 car-rce rt LC, Meg ntfil -tc:0 171. bos er/Aii,s 29 March 2021 at 14:32 EFTA00269190 ciortilaart e : reg. sicfc m - Jacqueline Pearce - Outlook Service Ticket #621581 - Jacqueline Pearce - Email Hack - 0400404658 Pit Stop Technologies Thu 9/07/2020 924 AM To: Hello Jacqueline, Service Ticket # 621581. has been completed. We hope that you are satisfied with the service provided. If you do not believe this ticket has been complete or have concerns, please respond to this email so we can address your queries. __— Thank you, Pit Stop Technologies Team VAVW.glast du Ticket #: 621581 Status: Complete Summaryrtacqueline Pearce - Email Hack4f0400404658 Top REEP:AIC YOtla IT O, ne .4 CX. Service Record #621581 Summary: Jacqueline Pearce - Email Hack - 0400404658 Company: Jacqueline Pearce Contact: Jacqueline Pearce Phone: 0400-404-658 960 1/1 EFTA00269191 *-FecEE3G0K - so site---ss mows) f•C( mew) e-G0C-# Page 1 of 1 02Ol 1 Subject: New messages from Andrew Leske Fro„a C.Q1OeNCE: F Fite f3t)Ct Ta ()S NESS C CON-1- *, Date: Thursday, 25 Augu 20114:11 PM Andrew Les!ce the Family are going to use their popularity and venue to provide advertising opportunities for small businesses around the towil(aimiiiRroWtaly a —.Pe of business, and not like 3 or 4 hairdressers, once we got one thats it). they have 2 large tvs and a projector coming which they will show your advertising on from 10/1030 -1/130 every single saturday night. i am putting together an info sheet with how many people they get the ages and genders. this works in adelakle, and i c:ftonestly can not see why it wouldnt work here. already spread the word to other places and they are keen as mustard, so I thought i would aask you if be keen. another thing is the original 10 businesses that sign up will be locked into that price so if prices go up you wont need to worry about we (they) are looking at $100 a month or $1000 a year which ever you choose. i think that i have grabbed all the responsibility and workload so you would continually deal with myself have a think and let me know ay Thanks Leske • *• View Conversation on ifacebook • Reply to this email to message Andrew !Asia 0120 RAI Es et< - pagus H 1\)OLie RE to (M A gkerti<)4 I t_ccice..-_rf) ACCESS TO FA es - C:r.reitrit<6 P ROF6SS (01%‘Al- c:c. v 1/424C, Recis.).657-co copy or PAsseorr ti0 tlEtC (1&"Ct -TO d RCA-FE rACEBCOt. Ar7r 0 t•C e2O 620 . RACE: cc < PROF10E- (.4,QtY Or4 CKS-Or EFTA00269192 ce.SOAL RCaer - SLACK tilARICer Ext.),V- A/30,SE RING - ,oNtirk 7/14/2020 Mail - Jacqueline Pearce - Outlook [RSVP up ort Re: RE ro de the port] xual targetin. Re: Tue 26/04/2016 3:21 AM To: Jacqueline Pearce ## Please type your reply above this Inc l -4tC uspected rofile theft black market sex Your request (#31318Q) has been updated. To add additional comments, reply to this email; i c- • Nick (RSVP Support) la 26 Apr, 08:21 Dear Jacqueline, Thank you for your email. We are more then happy to provide any and all information relating to your profile. However, we are unable to locate any recent profiles with the exception of Degreesofvariability.* — ONCitN)C t /N'T (NI& CROHLE As this profile has been inactive for a period over 6 months all contact history and content has been permanently deleted from our servers. I can reactivate this profile for to see if there is any information that may be of use to yourself. If you wish for this to be actioned could confirm your date or birth I can reactivate this profile on your behalf. Kind regards, Nick Customer Support Executive Pty Ltd ABN 86 067 935 737 Where more Australians meet. Jacqueline Pearce 25 Apr, 18:19 This is a follow-up to your previous request 01236€ "Suspected profile theft - Dear Nick, Thankyou for contacting me as quickly as possible. I am in the middle of legalities involving the suspected sexual targeting orchestrated by a group of prominent people in prominent positions which include Su EFTA00269193 7/14/2020 SEX- ee- A tSSn -X-1 Mal-Jacqueline Pearce -outlook RefORC INY.A • --- r ttl ASS‘ST DeM I ETD , Jacqueline Pearce 26 Apr, 12:01 This is a follow-up to your previous request #313180 "RE: [RSVP Support] Re: Susp..." Dear Nick, Thank you very much for the information. Yes, that is my profile of which was in use upon your site. Birth date - Just a query.. Are you able to extract the information from the main hard drive of your system? Although this may take some time and be of an inconvenience to your staff it is of high importance and priority concerning the circumstances. I fear and suspect that I may not be the only victim of this crime and the information of which I am asking is of high importanc- d •ersonal contact with a member of your service which resulted in exual assault. 2 c This member had been in contact with myself in the yea 20T2F.7 Any information of which I have requested and of which you could supply will be greatly appreciated. Kind Regards • Jacqueline Pearce This email is a service from RSVP Support. EFTA00269194 • • • WM .0011.../ Mall - Jacqueline Pearce - Outlook .M- cRa's 000_6 A cc..Q6NTS Microsoft account unusual sign-in activity Microsoft account team jsr Wed 21/10/010:07 AM Ac To: Mi X Unusual sign-in activity* We detected something unusual about a recent sign-in to the Microsoft account To help keep you safe, we required an extra security challenge. Sign-in details: Country/region: Australia IP address: Date: 10/21/2015 10:07 AM (LHST) If this was you, then you can safely ignore this email. If you're not sure this was you, a malicious user might have your password. Please review your recent activity and we'll help you take corrective action. To opt out or change where you receive security notifications, click here. Thanks, The Microsoft account team https://oullookilve.corn/mall/O/M1MIADAwATNOrnYAZC1jM2U5LTZhNWMOADACLTAwegAuAAADXVQ1yWIcnOla0W4CohQ6GAEAXoEEIVe2F... 1/1 EFTA00269195 7/13/2020 Mel- Jacqueline Pearce - Outlook kith SEcO CTy - ACCOUNT- rt —rf ) ics op perrE Microsoft account security info Microsoft account team +; Thu 11/021 0,8:56 PM To: At Microsoft account 4t Security info replacement AE. Someone started a process to replace all of the security info for the Microsoft account • If this was-you, you can safely ignore this emaAour security info will be replaced with when the 30-day waiting period is up. If this wasn't you, someone else might be trying to take over here and we'll help you protect this account Thanks, The Microsoft account team . Click Ili.42U5LTZhNWMIMDACLTAwCgAuAAADXVOlyWIcri0taOW4CohO6GAEAXGEEM2F... 1/1 EFTA00269196 7/13/2020 . Mail - Jacqueline Pearce - Outlook Ct I POSS woKv or oft=yre- sctue try * Your password changed Google <r Wed 5/121 1 )11:10 AM 4 * Go gle Hi Jacqueline, The password for your Google Account was recently changed. Don't recognize this activity? Click here for more information on how to recover your account. The Google Accounts team This email can't receive replies. For more information, visit the Google Accounts Help Center. You received this mandatory email service announcement to update you about Important changes to your Google product or account. t 2018 Google LLC, 1600 Amphitheatre Parxway, Mountain View, CA 94043. USA IFINIIIIIIIII/maill0/A0MkADAwATNIZmYA2C1jM2USLT2hNWMtMOACLTAK:gAueAADXVCOMIcnOia0W4Coh06GAEAXoF Ei%2F.. . 1/ EFTA00269197 7/13/2020 Mel - Jacqueline Pearce - LOH POIEA 1—‘1:3CACI NY% RavloTe Microsoft account unusual sign-in activity Microsoft ount team < kr. Wed 10 06 020 0:22 AM To: Microsoft account Q.C) G(A) AcE toicce5 Unusual sign-in activity*' We detected something unusual about a recent sign-in to the Microsoft accoune Sign-in details Countrnregion: Australia IP address: Date: 6/10/2020 10:22 AM (LHST) Platform: Mac OS Browser - Please go to your recent activity page to let us know whether or not this was you. If this wasn't you, we'll help you secure your account. If this was you, we'll trust similar activity in the future. To opt out or change where you receive security notifications, click here. Thanks, The Microsoft account team IM2U5LTZhNWIMMDACLTAwCgAuAAADXVCIlyWico0laOW4Cotio6GAEAXoEEI%2F... 515 EFTA00269198 11t 21020 Gmal -.Secunly alert change your Weft password 1/49_090 POI Gmail * Security alert: change your Netflix password *. 1 message Ne ix To: ME1TL) 23 September (020~t 16:16 Action needed: reset your password Dear Jacqueline, * We've detected a suspicious sign-in to your Netflix* account. Just to be safe, we've reset your password and you'll need to set a new one. Use the button above, or type www.netflix.com into your browser, click on "Sign in" and then click "Need help?" Follow the instructions to set a new password. If you have any questions, we are here to help. Visit the Help Centre for more info or contact us. —The Netflix Team VIEW ALL TV SHOWS & MOVIES Questions? Visit the Helo Centre. Netflix International B.V. 678606... 112 EFTA00269199 c meal-6K HP pescrc p QC2I gLer cei ? NC, _HO L-4OO0 S OCT+ i - C- NA g t_ SVszceas 3/2912021 M Gmaii Gina - Reporting Fraudulent Activity Jacqueline Pearce 1.c.pearce456@gmail.c Reporting Fraudulent Activity 1 message Ja > 29 March 2021 at Toe Dear GoDaddy, Higher Authority, I am contacting you on the advice of your representative Cristina, Sydney on reporting a case of Malicious Fraudul Activity that has occurred in my business account JC INNOVATIONS, customer The Fraudulent activity targeting my accounts has been occurring over a 10 year period and has targeted numerot accounts, Wilily accounts. Phone accounts, email accounts, computer hacking, Centrelink accounts and recently Netbank electronic transfers to my Publishing House Austin Macauley Publishers, London which has been report( to the Commonwealth Bank today and placed with the Fraud Divison for investigation. On Thursday i have reporte Fraudulent Activity occurring for the second time in my Telstra Mobile phone business account that has Restricted Access because of the previous Fraudulent Activity that has occurred in my -Jersonal accounts with 2 different servers. This report was made in the lelstra Store, Kadina and escalated toteguesting contact with Teistra Head -# office CEO for investigation and reported as continuous Fraudulent Activity. )1F-LeeeNrri r I E..p We) Pot. C....c_ICEP-ICA-net‘ITSOORCE - ReeeCle- ACIESS CAN EQ,S . I was informed by a representative of your company to contact and report any unusual activity or suspicious activi' occurs during the setup process of this account, as i had informed the representative of the previous hacking of m previous computer system and email account, which resulted in 136,000 malware report on that computer. Following this report of the malware i purchased a new computer system registered in my registered business nar and professionally setup by a Computer technician, which included numerous Security systems, newly created accounts and emails and my newly created business phone account and new phone number. This newly created accounts and business computer were registered under the business registration JC INNOVATIONS and not as a personai user. —4 On start up of the new computer system i received 96 hacking attempts in 2 days which prompted me to get the support of the IT Specialist Pitstop Technologies, Kadina for the computer set up and Security measures installed Following this news set up of the computer, newly created business phone account and newly created accounts i started to receive suspicious sign ins and suspicious activity in these accounts. Following the publication of my novel 31st October 2020 connected to the email started to receive blocked access to Social Media, suspicious sign ins to social media, blocked contact with my publishing_house, fraudulent emails coming through to the synchronised me ail of this email address to my phone i was not receiving on my computer. I am reporting the email as being targeted and hacked with Malicious Activil and Fraudulent Activity and am requesting an investigation into my account. I have once again changed my phone number and have recently removed the 2 step verification on my account to this process and am in the stages of changing the details, password, phone number, 2 step verification on my account for security purposes but wished to request an investigation into this account before i change my details it s I have attached documented evidence of the targeted malicious activity that has been occurring for you to reviev part of this request to investigate this matter further. appreciate your time and assistance regarding this matter. Kind Regards Jacqueline Pearce JC INNOVATIONS 4 2 attachments L - RCI, Ogrie.A.11004 CC 50Pf'r...I aj 1. Report,pdf 2000K EFTA00269200 3/2912021 Gmail Gmail - Thanks for your report. Well take it from here. Thanks for your report. We'll take it from here. 2 messages GoDaddy Jacqueline Pearce •1.c.pearce456@gmail.c 29 March 2021 at • 24/7 Support: GoDaddy Customer— Customer Number: Thanks for submitting your report. We can't guarantee any particular outcome, but welt review your complaint and contact you only if necessary. If you submitted your report using the abuse reporting form, additional submissions from this address within 24 hours won't receive another notice of receipt. If you've submitted via email, consider using the abuse reporting form below for any future complaints. For other issues, check out these resources: Trademark or copyright complaints Submit them here. Domain disputes Please refer to ICANN's Uniform Domain-Name Dispute-Resolution Policy. Account changes EFTA00269201 tARRKETIW. POSLISHC11) P.;01/4166- UMBER 90,20 - (Weil? W..cace,c) MeRKETI ItiC RECeiOM4C; CONTACT tJeu_ STREFT If plioN)E elvli) U._ SERVICE- Icrr RecEivi C otv sykttiRoNtscn cot-ten-ER CMfflL sakvice - TeR..ciET0QC C Linkedln Simon Sinek and others share their thoughts o Here are your network highlights Linkedln Simon Smek shared a post: On January_ Here's what s happened since you were last on Linkedln Forbes and others share their thoughts on unk. Here are your network highlights Linkedln N C c 110 Simon Sinek shared a pool: We all.. Here's what's happened since you were lest on.. inkedln e Wall Street Journal and others share their.. - ere we your network heohlights 0( ) (61+ Linkedln Holly, add Atlyson Carpenter MBA to your netw. cc-P vt's Add connections to discover new opportunitie_ Linkedln t WORK i.OR SA .7. Icf.is:7; 0 . Hotly jati, scn WORK, f-rift dr••:9 V.:In.:9110 EFTA00269202 t-tonbeen (QC VI DEO St, t3M inex3 mr*Ken &C.4 pePaRmiari- FOR SOcilfte- meo ke EsPoskAe-- Ni O N01 MARKET NOQEL, Holly Jackson From: Sent To: Subject Linkedin < Tuesday, 24 November 2020 6:43 PM Holly Jackson Congrats! Your video is ready to watch! Holly Jackson Congrats! Your video is ready to watch! Reality - A riveting, thought provoking journey of one... Go to Linkedin Rae! %Jab t.-X) ax-tec Mane s n-t; Euxten rteRiteriNct Get the LinkedIn app. Stay updated wherever you are Download for free Unsubscribe I Halo You are receiving Linkedin notification emails. This email was intended for Holly Jackson (Book Author at JC INNOVATIONS). Learn why we included this. Mr' (0 2020 Linkedin Ireland Unlimited Company, lAfilton Plaza, Wilton Place, Dublin 2. Linkedin is a registered business name of Linkedin Ireland Unlimited Company. Linkedin and the Linkedin logo are registered trademarks of Linkedin. EFTA00269203 TG cmeic, ADDRESS PROM HorJE "140 PRt 3/2912021 DIID "tr Realue ON) at -In -I -W e're t° see you go P01 Gmail FW: We're sorry to see you go 1 message b9t Hol acksa k To: Jacqueline Pearce 1 29 March 2021 at 15:10 k c riceicc ("Howe- SY,\IC.Ht:c.t.:itSCiTh y frior r fib NCT Beta:( c cc friruirik emost ≤ is Tow 5 . FiCCCO•Yr Cue F-Rteit-MXL-;\-ti Sent from my Samsung Galaxy sman,ohone. -- Original messaoe From: Linkedln Date: 24/3/216:6 it To: Holly Jackson Subject: We're sorry to see you go Linked MI We're sorry to see you go Your Linkedln account is now closed. Although you no longer have access to it, it'll take a few weeks for your public profile to disappear from search engines. You may still receive invitations from Linkedln members and groups. You may reactivate your account within 14 days from today by signing back in, or if you wish to reactivate within the next 48 hours, you may use this link: Reactivate my account Thanks, The Linkedln Team This email was sent to holly.jackson@jcinnovations.com.au. Linked® '112021 Linkedln Corporation. 1000 West Maude Avenue, Sunnyvale, CA 94085. Link:feta ei iutne Linkedln Iccio are rigistacad tradeMartis of Linkedin. EFTA00269204 TC.J C-Tiwto MCLcci\TC - holt./ jac Le-or)C1/4„, :Finn° \;olionS .aftl THIS nactiCiT HAS Si.."...c.PtAIDED c),:e. -co -THE Socr'ciocs \jos/ By Th)riTER 13Lcci•eal NeRt=e-ritt CF Pc:ex-I:Si-Celt) &CK Holly Jackson From: Twitter .1 • Sent Wednesday, 11 Noyembe 020)0:08 AM 4K - (Nz. Y-CTI pa/A To: ollya BCCC compaeCet • Subject new or unusual Twitter login ,V (tac tSHI Net Hot. a,tirtPCI conrittilcr V that seem you? If this was you Just to be safe, to log in to this account you'll need to verify this is really you by entering the following single- use code. jqrvrvk8 If this wasn't you Complete these steps now to protect your account. • Change your password. You'll be logged out of all your active Twitter sessions except the one you're using at this time. • Review the apps that have access to your account and revoke access to any unfamiliar apps. Learn more. Help Not my account Email security tips EFTA00269205 tTTER. C.C.a.)nat rie sper,vr-tir -) SCCP c Act( Cr/ . EFTA00269206 fteces1/41E-0 NO kefty gecArzt);N\ct MARKcrs& Cr Noa gentry Neve: HA° PREAl I cx)5 coN cr WITH -rt-tIS ccarrncr gefuED , coc_v-6 tit etzte -rif.c; 4c Holly Jackson From: •A Sent To: Cc: Subject: At Attachments: Dear Miles Kemp, Holly Jackson Sunda 14 Feb oy ac '.n Book publishina marketing 1:51 PM ->k" Reality - New Release.mp4 - MARse....efrinki V il>60 Reet...rry . I am contacting you today to inform you of an Australian publication of a first time author, contracted with Austin Macauley Publishers, London. The novel "Reality" was produced over a 6 year period and the author Holly Jackson gained her first contractwithin a 3 month period-of submitting one chapter, the main chapter and name of the book "Reality". "Reality" is the first edition of a series of books, the completed story broken into 4 books. The release of the novel in London and on Ebook was released on the 301° October 2020 and is new to the market. Holly Jackson (author penname) was born in a country town of South Australia and began an ambitious struggle of education and success in business development before putting pen to paper and began a 6 year journey of discovering and developing her writing style and completing her first novel. Within the time of writing the first novel Holly began the construction of the second edition and then the third edition, before in 2020 beginning the forth edition of the series. Following completing the second novel in 2020 Holly submitted the completed manuscript to her publisher, Austin Macauley Publishers, London and gained her second contract within a 3 week period, following a brilliant review by the publisher. The second novel is now in the editing stages with the Production Department of Austin Macauley Publishers, London and is being developed for publication. The publication date of the second book of the series Is still undated and unsure due to the effects of the Coronavirus which has hit that part of the world hard and caused numerous delays and problems, of which the publishing house has also been affected and suffered. "Reality" — A thought provoking journey of one woman's fight for survival and success An emotional journey of eroticism, danger, entrapment, escapism, hope and faith in love and triumph over adversity, and the dark secret that lay hidden in the shadows of the lies that surrounded her. Gripped and trapped in the sinister evil, lurking and twisting around every step of her strong will to survive and succeed. Will she succumb to the cruel twisted fate of her adversaries, the sexual temptation of her misguided path or find the strength within to reach for her destiny and succeed? Jade, one woman's journey, this is her story, this is her reality. Inspired by true events. I am submitting this marketing material for you to review and hopefully attract your interest in promoting this new Australian talent that has just entered the market of writing. Please contact me with your thoughts and interest if you would be interested in knowing more or doing a promotional article. I appreciate your time and consideration. Kind Regards Holly Jackson 1 EFTA00269207 r)ir) NC't • t<4_ %( MARKEONC, BCOK . Nichcatt r, CIP-Lv•ccx.c, tcc- Jacqueline Pearce From: Sent To: Cc: Subject Attachments: Dear Yanxia, Jacqueline Pearce 9 Janua 021 10:30 AM Jacque ine Pearce RE CONFIDENTIAL - NDA Re ' ments eality New Release.mp4; Marketing.jpg * - I am doing really well, thank you. • I hope you are doing well too? Thank you for your email, it was good to hear from you, and yes it has been a while. As you are well aware it has been troubling times with the virus present in our society's. I hope the epidemic has not affected your company or you, or your families in any way. I wish you well always. At this present moment I am concentrating on the newly released publication of my first novel "Reality'.' It has taken some time to reach this point and I am right in the mist of it all, so very exciting buialioniore work to do as it requires as much marketing as possible in order to reach the level of success I am hoping for. This process could take some time to complete so all my efforts nconcentrated in that area at the moment. I have 4. included a marketing video of the published novel for you to viewind would like to ask if you could please share it with people in your location, I would appreciate it very much. I have also attached a copy of the publishing house I am contracted with for you to view and share if any interested parties are interested in purchasing a copy. At this point because of this process I am involved and because of the epidemic of the virus I have currently placed IC INNOVATIONS developments on hold until about the middle of this year. I would be interested in any discussion concerning the projects we have previously discussed after this point if your still interested. I hope this email finds you well. Lets stay in touch. I would appreciate any assistance you could provide concerning my current project, the marketing of my first novel. Thank you, stay well. Take care Kind Regards Jacqueline Pearce Director : JC INNOVATIONS From: Yanxia Zhao Sent: Friday, 15 January 2021 1:36 PM Jo: Jacqueline Pearce -Subject: RE: CONFIDENTIAL - NDA Requirements Dear Jacqueline, How are you recently? It has been a long time since I heard from you last time, I would like to express our sincere wishes to you and try to explore any possibilities of starting our discussion again to find out a suitable way for us to wo together. As discussed, I think we can start our cooperation from something small and isolated if you thii that's more convenient, please kindly let us know if this can he considered. Thank you so much in advani 7. EFTA00269208 AUST N MACAU LEY PUBLISHERS TM LONDON • CAMBRIDGE • NEW YORK • SHARJAH Media and Communications Getting to know you & your book... Congratulations! Your book is now published and has been passed to us to start the exciting journey of marketing your book! We work hard to make sure we maximise all opportunities possible — to do this its helpful for us to understand your journey so far by completing this questionnaire. *Please indicate if_you ash fir airy detail( to swain confidential. • Full name Pen name Date of Birti.,i) +<:ok Genre Citizen of Home address Home phone number Mobile phone number 4 Email address Jacqueline Pearce — Please do not provide my real name to any source Holly Jackson — Prefer to be known as to other sources 021 /01/1971) Reality Riveting Drama — Inspired by true events Australia Please do not provide my home address to any source. Ne.v%4 SYSTEM 9O U We may pass on your contact derails to interested parties, including but not limited to local press and media, libraries, bookshops, charities and schools. Are you happy for us to do so? YES xpl NO ID COR/J0-11/2017 EFTA00269209 et-vct-cres) pock c e tNvCLUEMcNT Page 1 of I • 'k tNn pRz,c OE -TriesE 6-119 Icy c,tD Not sCiPpul Nci S n Pcurc c r C.c.,kactx H ARR1 HCC:K - f\sCir CA) WEt3c.:, iT6 CP" Balf4C, t-letiagg Cf BOW Fie. r5 HP ?PART %', RE: Your letter dated 10/03/2020 I Office of Adam Bandt MP Hook, Harr. Banc7t71P1)<Harry.Hook@aph.goy.au> 627/03/20. 1:16 AM To Dear Jacqueline, )%nkti. t.)67 egOVIDE --- Fls c oi.JTAcTi" beTA Thank you for contacting Adam Bandt MP with your letter and documents dated 10/03/20. My name is Harry and I am responding on Adam's behalf. I am sorry that you are experiencing hardship and feel that your safety is at risk from targeting. I would advise you to contact the police if you feel there is an imminent threat to your safety or the safety of others. Further, I commend you foneeking solutions to some of the biggest problems facing us today, such as housing, infection control and waste management and wish you the best with those endeavours. I regret to inform you that as a federal MP, Adam cannot intervene in legal matters, nor investigate cases such as yours. Thank you for writing to Adam, and please don't hesitate to contact us again in future with any other queries or concerns. Best wishes, Harry Ha t.lice c Office of Adam Bandt MP Leader of the Australian Greens and Federal Member for Melbourne GEL, 296 Brunswick Street, Fitzroy VIC 3065 EO Pronouns:lie/him Sign up for regular updates I respectfully acknowledge the Traditional Custodians of the country on which I work. the Wurundjeri people of the Kuhn nation. I recognise that sovereignty was never ceded and pay my respects to Elders past present and amercing. ( INTIERCEPTE, lMAIN.I FI 601DeNCE TO A SENATORS ofr- CE 566R( Nd ASS (STAN e- c20QC - rePERAc- Mei seEk - MetaciN5 l... .4.1 • Mrvn nein, /A f;nkew / A /MIL A 11 A us A Thii7vrtV A 71'1 Rif/T ICI T7h EFTA00269210